HEX
Server: Apache/2.4.58 (Ubuntu)
System: Linux ns3133907 6.8.0-86-generic #87-Ubuntu SMP PREEMPT_DYNAMIC Mon Sep 22 18:03:36 UTC 2025 x86_64
User: cssnetorguk (1024)
PHP: 8.2.28
Disabled: NONE
Upload Files
File: //sbin/ddns-confgen
ELF> +@�Q@8
@@@@��   ��@@@��HLH\H\� XLX\X\88800hhhDDS�td88800P�td�I�I�IttQ�tdR�tdHLH\H\��/lib64/ld-linux-x86-64.so.2 GNU���GNU!��H$-+��Kt�݉N=`��GNU0Д�a`
I��@0123578<=>?@��k�|�3�r�qX17�v��|�K�k	C���a*v�.���k��hqCE��3b��
:��e�m������5 R#�n��� z�������g,y��B�d���I��|l�, �g�<V��F$`-OS�$V-@`B `vp,�Nha�@5`�H`ap2vp�.��@-Z`; +&7 `X"S�-���/�_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTable__libc_start_main__cxa_finalizestderr__fprintf_chkstrncasecmpstrcasecmpgetpwnamfilenofchown__errno_location__vfprintf_chkfputc__stack_chk_fail_exitdst_lib_initdns_rootnamedst_key_generatedst_key_tobufferisc_base64_totextdst_key_freedst_lib_destroyisc_result_totextisc_assertion_failedisc_file_prognameisc_commandline_errprintisc_commandline_parseisc_commandline_argumentisc_mem_debuggingisc_commandline_optionisc_commandline_indexdst_hmac_algorithm_totextisc__mem_create__printf_chkisc__mem_putisc__mem_destroyputsisc_mem_statsstrlenisc__mem_get__snprintf_chkisc_file_safecreatefflushferrorfcloselibisc-9.18.39-0ubuntu0.24.04.2-Ubuntu.solibdns-9.18.39-0ubuntu0.24.04.2-Ubuntu.solibc.so.6set_userverbose__data_start__bss_start_endnotify_edatawrite_key_filefatalalg_fromtextgenerate_keyalg_bits_IO_stdin_usedGLIBC_2.34GLIBC_2.4GLIBC_2.3.4GLIBC_2.2.5����ii
�ti	�ui	�H\,P\�+``�_�_?�_�_�_�_�_�_�_�_"�_'�_/�^�^�^�^�^�^	�^
�^�^
�^�^�^�^�^�^�^____ _(_0_8_ @_!H_#P_$X_%`_&h_(p_)x_*�_+�_,�_-�_.��H��H��?H��t��H����5J>�%L>@��h���f���h����f���h����f���h���f���h���f���h���f���h���f���h�r���f���h�b���f���h	�R���f���h
�B���f���h�2���f���h�"���f���h
����f���h����f���h��f���h���f���h����f���h����f���h���f���h���f���h���f���h���f���h�r���f���h�b���f���h�R���f���h�B���f���h�2���f���h�"���f���h����f���h����f���h��f���h ���f���h!����f���h"����f���h#���f����%.=fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%~;fD���%v;fD���%n;fD���%f;fD���%^;fD���%V;fD���%N;fD���%F;fD���%>;fD���%6;fD���%.;fD���%&;fD���%;fD���%;fD���%;fD���%;fD���%�:fD���%�:fD���%�:fD���%�:fD���%�:fD��U�H��AWAVAUATA��SH��H��H�>H�5s;dH�%(H�E�1�HDžx����T������FH�-;H�
>;�=7;lH�u�=,;t��DL�(H�5#"L���~�����tH�5"L���k�������ƅW���1���;H�E:A�����L�5�"DžX���L�-�"�HDž`���HDžH���HDžh���ƅV���@L��H��D�������������?��;��IcD�L�>��f��=Y;��H��9H�H��h���밃=9;��H��9H�H��`���됃=;��ƅW����w�����=�:��H�t9H�H��H����M���DH�Y9H�H��H��X�����A�DŽ��P�����X��������H�	9����fDH��8D�A��?tkH��8H�
j9�H�� H�81������H�5l L�������uQƅW�����<����=!9-�����H��H����1��H�tsig-keyH��8��8ygen���H�5 L���G���ƅW����¸������H�
 ��|H�=���ƅV��������=�9uH��7Hc�HH�É
H��h���H��`���tH��H����	���H��7D9 �����E��L��x���D���
���L��I������H��h�����E1�1�1�H������fv�D����X���Dž����!fuB�H��x���H������H������H������Dž����)��������W���t}L������D������L��1�H��h���H�5Y����H��tH��x���Ic�1�H��������V����L�����H�E�dH+%(��H�e�1�[A\A]A^A_]�H�=^�1���L��L��h���L������D������H�5��1�L���#���H��`���H��tsI��H��L��H�5�1����H�=������;���H�6H�
�6�H�FD�H�&6H�81��������H�=�1���H��H���H����H��h���H�56�1��z����z���H��5H��x���H�0��������=37H�0H� HE�H��h���H��`���H��H��tmH��H��8������H��x���1�D�x
Ic�H��@�������L��H��PH��8���1�H��QL��h���H��H��@������ZYH��h������H��H���H��t$H���H��h���H�5�1�������1�E1��H���H��X���H�=�1�����f.���1�I��^H��H���PTE1�1�H�=������4�f.�H�=�4H��4H9�tH�64H��t	�����H�=�4H�5�4H)�H��H��?H��H�H�tH�E4H��t��fD�����=U4u+UH�=�3H��tH�=&4����d����-4]������w����UH��S��H��H�&4�=75H�H��3H�8tH�A�1��u���������H���1��[�����f���U�H�5)H��SH��H������H�5��H�C��HD�H���$����¸������tH�5�H���
����¸������teH�5�H�����¸������tKH�5�H�������¸������t1H�5�H������¸������tH�5�H����������H�]���@����c1�@��w@��H�&���f���UH��ATSH��H���
���H��tD�`H������[�����D���A\]�������������[A\]Ð��UH��SH���H��H���H��P���H��X���L��`���L��h�����t#)�p���)M�)U�)]�)e�)m�)u�)}�dH�%(H��8���H�2�8uH��8���dH+%(ubH�]���f�H��1H�EH��H�� ���H��(����H��@���H�;H��0���Dž ���Dž$���0�u���H�3�
�H�����1���UH��ATI��SH���H��H���H��P���H��X���L��`���L��h�����t#)�p���)M�)U�)]�)e�)m�)u�)}�dH�%(H��8���H�21H��0�H��H�;H�1���H�;H�EL��H��(����H��@���H�� ���Dž ���Dž$���0H��0�����H�3�
�Y���ff.�@��UH��AWAVAUATS��H��dH�%(H�E�1�HDž(���@�����I��A��I��@�����@���t�F_<��A�D$�=��H1�L���T����L�5�H�5�1�L���t�����A��1�H��/H��(���E1�D��H�8jSAUj�F�H�� ���I1�H�5�L���)���f�H�E�H��(����D���H��@����T����p���fv�Dž@���!fuBH��H���DžP���@)�`����S���1�H�51L�������@���!fuB�H��H���L��H��0���H�������H��0�����T�����8����e����1�H�5�L���\���H��(���tH�����%�H�E�dH+%(udH�e�[A\A]A^A_]���B�=��t�����H�=a1�����H�="1���������H�5EH�=7H��1�����������H�5H�=H��1��������H�5H�=�H��1�����H�
1ҾCH�=�u���N�H�5�H�=�H��1��F���D��H�=t1��5���D��UH��AWAVI��AUI��A��ATI��SH��H��(dH�%(H�E�1���H�u�L��H�E�I�������1�H�5VH�=7����M��t:H�E�L��H�E���H����H�}�D�`������D�������tvH���sD�KL��H�}�H��M��1���|�H�}����H�}��j�ZY��uyH�}�����u[H�E�dH+%(uGH�e�[A\A]A^A_]����H�=�1����������H�5yH�=VH��1������L��H�=�1�����L��H�=q1������H��H���Usage:
 %s [-a alg] [-k keyname] [-q] [-s name | -z zone]
  -a alg:        algorithm (default hmac-sha256)
  -k keyname:    name of the key as it will be used in named.conf
  -s name:       domain name to be updated using the created key
  -z zone:       name of the zone as it will be used in named.conf
  -q:            quiet mode: print the key, with no explanatory text
Usage:
 %s [-a alg] [keyname]
  -a alg:        algorithm (default hmac-sha256)

keysize %d out of range (must be 1-512)
keysize %d out of range (must be 1-1024)
../../lib/isc/include/isc/buffer.hThe -r option has been deprecated.# To activate this key, place the following in named.conf, and
# in a separate keyfile on the system or systems from which nsupdate
# will be run:key "%s" {
	algorithm %s;
	secret "%.*s";
};

# Then, in the "zone" statement for the zone containing the
# name "%s", place an "update-policy" statement
# like this one, adjusted as needed for your preferred permissions:
update-policy {
	  grant %s name %s ANY;
};

# Then, in the "zone" definition statement for "%s",
# place an "update-policy" statement like this one, adjusted as 
# needed for your preferred permissions:
update-policy {
	  grant %s zonesub ANY;
};

# Then, in the "zone" statement for each zone you wish to dynamically
# update, place an "update-policy" statement granting update permission
# to this key.  For example, the following statement grants this key
# permission to update any name within the zone:
update-policy {
	grant %s zonesub ANY;
};

# After the keyfile has been placed, the following command will
# execute nsupdate using this key:
nsupdate -k <keyfile>hmac-md5sha1sha224sha256sha384sha512%s: unsupported algorithm %d
initialize dst library%s: %sgenerate keydump key to bufferISC_BUFFER_VALID(b)bsse64 encode secrettsig-keyddns-keytsig-keygentsig-keygen.exeddns-confgenddns-confgen.exeunreachabletsig-keygen.cUnsupported algorithm '%s'%s: invalid argument -%c
%s: unhandled option -%c
a:hk:Mmr:qs:y:z:%s.%screate keyfileunable to set file owner
write to %s failed
fclose(%s) failed
X���������������@��������������������������������������<��������N�������������������;p
|��������������|��l������<��P�|�������� zRx���&D$4���PFJw�?9*3$"\���t���@�h�WA�C
A� ����E�O
A���X�(�d�OE�C
C��j
ET ���E�C
H�}
C0T��E�C
B�K�,P4��E�C
I������
H,�$��VE�H
H����D�I
A,���vE�C
D��E�I�D��
A,�+�� 
�3H\P\���o��
`
�h^`�@h	���o���o����o�of���oX\0 @ P ` p � � � � � � � � !! !0!@!P!`!p!�!�!�!�!�!�!�!�!"" "0"@"P"`"`/usr/lib/debug/.dwz/x86_64-linux-gnu/bind9.debug8DyN�~��+Sq�#yz�K�f1df48242d2bc8c94b74fddd894e3d60e9e08c.debug�q�b.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.dynamic.data.bss.gnu_debugaltlink.gnu_debuglink880&hh$9�� G���o���Q``0Y�
�
�a���off�n���o��P}@@h�B��`�  �    P�p"p"��"�"@��$�$&��3�3
�@@�	 ��I�It�JJ��H\HL�P\PL�X\XL�h^hN��`P� `PH PEXP4�P"